PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154204001
Common NameGSBRNA2T00154204001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 1041aa    MW: 114044 Da    PI: 6.87
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154204001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.3e-23127228199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+F +
  GSBRNA2T00154204001 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIFRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVR 215
                          99*****************************98888885.9************************************************5 PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                            + +++l+++++r+
  GSBRNA2T00154204001 216 --DGKGQLLLGIRRA 228
                          ..468889****997 PP

2Auxin_resp117.79.7e-39253335183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  GSBRNA2T00154204001 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                          799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.4E-42121242IPR015300DNA-binding pseudobarrel domain
CDDcd100172.92E-20126227No hitNo description
PROSITE profilePS5086312.308127229IPR003340B3 DNA binding domain
SMARTSM010192.9E-23127229IPR003340B3 DNA binding domain
PfamPF023624.0E-21127228IPR003340B3 DNA binding domain
PfamPF065078.8E-34253335IPR010525Auxin response factor
PfamPF023092.6E-9911999IPR033389AUX/IAA domain
PROSITE profilePS5174526.1749131006IPR000270PB1 domain
SuperFamilySSF542778.83E-9926991No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1041 aa     Download sequence    Send to blast
MKAPSSNGVS PNPLEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLQ NVTLNADPET EEVYAQMTLQ PVNKYDRDAL LASDMGLKIN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIFRGQPKRH LLTTGWSVFV STKRLFAGDS VLFVRDGKGQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFAGQPGM PDDGTDMECA LKRAMPWLDN GLEMKDPSST IFPGLSLVQW  420
MSMQQQNGGQ VPSSAGFFPS MVSPTAAMHN SLGGADDQSK LVSFQTPPGG ISSSNLQFNK  480
PNLQGAMSQL PQPPTTLSQQ QQLQQLAQQL QSHTHPQPQQ SPPHPQPQSH PQQLQPHKLQ  540
QFQLPQNQLY NGQPAVQQRQ SQQASMHHLQ SQVVSGSIAS SVIAPPSSSL NQSFQQQQQQ  600
STQLQHTHRH IGASTSQSSV IETSKSSSNL MSIPPQDTQF SRQMEQQQPP GLFQLLQRLQ  660
QQQQQQFLSP GSSSLPSQLL HQQLQSQQFP QLPSPSQVQQ FPSSCTNTGL PSLQPPQTLV  720
SRPQDKQNPP VGGGAKAYSG ITDGGDAPSS STSPSTNNCQ ISSSTFLNRS QSGPAILIPD  780
PAADMSGSLV QDLYSKSDMR LKHELVSQQK PKASLTDHQL EANSLFGGGA NVENGFVPDT  840
LLSRGYDSQK DLQNMLSNYG GVTNDIGTEM STSAVRTQSF GIPNVPAISN DLAVNDAGVL  900
GGGLWPTQTQ RMRTYTKVQK RGSVGRSIDV NRYRGYDELR HDLARMFGIE GQLEDPLTSD  960
WKLVYVDHEN DILLVGDDPW EEFVNCVQSI KILSSAEVQQ MSLDGNFAGL PATNQACSGG  1020
DNGNGWRGQY DDNSATSFNR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1652135651388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154204001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794690.0JN979469.1 Brassica rapa subsp. pekinensis auxin response factor 7-1 (ARF7-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120773.10.0PREDICTED: auxin response factor 7
TrEMBLA0A078DU450.0A0A078DU45_BRANA; Auxin response factor
STRINGBra002327.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]